PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG075900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 253aa    MW: 25471.1 Da    PI: 6.2492
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG075900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.31.2e-5450145297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          +e drflPianvsrimk+ lPanakisk+aketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfe yv plk yl++yr
  Pavir.6KG075900.1.p  50 KELDRFLPIANVSRIMKRSLPANAKISKEAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYR 139
                          789*************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+egek
  Pavir.6KG075900.1.p 140 EAEGEK 145
                          ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-5047161IPR009072Histone-fold
SuperFamilySSF471133.26E-3853157IPR009072Histone-fold
PfamPF008086.4E-2755119IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.5E-1883101No hitNo description
PROSITE patternPS00685086102IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.5E-18102120No hitNo description
PRINTSPR006153.5E-18121139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MKSRKGYGGQ QGHLLSPVGS PPSDNESGAA AAAGCGSSAG YAGGGDSPAK ELDRFLPIAN  60
VSRIMKRSLP ANAKISKEAK ETVQECVSEF ISFVTGEASD KCQREKRKTI NGDDLLWAMT  120
TLGFEAYVGP LKSYLNRYRE AEGEKAAVGG ARHGDGAADE GPLGAGAVAA AAPADRAGHH  180
DAGGSMDVGL LMGVGAGGFG AGGGTSSYYS AAAGRAYGGD GSKVLEFDGE EENGRGMQRG  240
FGAGHLHGAV QL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4550140292Transcription factor HapC (Eurofung)
4g92_B3e-4550140292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.184134e-76root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1246521e-149AB124652.1 Oryza sativa Japonica Group Hd5 gene for imperfect Hd5 protein, complete cds, cultivar:Hayamasari.
GenBankAB6932011e-149AB693201.1 Oryza sativa Japonica Group Hd5 gene for heading date 5, complete cds, cultivar: Kitaibuki.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972725.11e-105PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233103e-64NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLK3YJ671e-104K3YJ67_SETIT; Uncharacterized protein
STRINGSi014286m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-55nuclear factor Y, subunit B3